RND3 (NM_005168) Human Recombinant Protein
CAT#: TP304479
Recombinant protein of human Rho family GTPase 3 (RND3), 20 µg
View other "RND3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204479 protein sequence
Red=Cloning site Green=Tags(s) MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Ex vivo tissue treatment (PMID: 27048969) |
| Reference Data | |
| RefSeq | NP_005159 |
| Locus ID | 390 |
| UniProt ID | P61587 |
| Refseq Size | 2712 |
| Cytogenetics | 2q23.3 |
| Refseq ORF | 732 |
| Synonyms | ARHE; memB; Rho8; RhoE |
| Summary | This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Rnd3 as a Novel Target to Ameliorate Microvascular Leakage
,Breslin, JW;Daines, DA;Doggett, TM;Kurtz, KH;Souza-Smith, FM;Zhang, XE;Wu, MH;Yuan, SY;,
J Am Heart Assoc
,PubMed ID 27048969
[RND3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
