CD34 (NM_001025109) Human Recombinant Protein
CAT＃: TP304446
Recombinant protein of human CD34 molecule (CD34), transcript variant 1, 20 µg
View other "CD34" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204446 protein sequence
Red=Cloning site Green=Tags(s) MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001020280 |
| Locus ID | 947 |
| UniProt ID | P28906 |
| Refseq Size | 2621 |
| Cytogenetics | 1q32.2 |
| Refseq ORF | 1155 |
| Summary | The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400668 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422593 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400668 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 |
CNY 3080.00 |
|
| LY422593 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 |
CNY 3080.00 |
|
| PH304446 | CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280) |
CNY 19520.00 |
|
| TP700209 | Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP724005 | Human CD34 Protein, His Tag |
CNY 4925.00 |
|
| TP762681 | Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1, 32Ser-290Thr, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
CD34 mouse monoclonal antibody, clone OTI11E1 (formerly 11E1)
