beta TRCP2 (FBXW11) (NM_033644) Human Recombinant Protein
CAT#: TP304407
Recombinant protein of human F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2, 20 µg
View other "beta TRCP2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204407 protein sequence
Red=Cloning site Green=Tags(s) MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQW SESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE WQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNW RCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVI VTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHR AAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEF QIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_387448 |
Locus ID | 23291 |
UniProt ID | Q9UKB1 |
Refseq Size | 4536 |
Cytogenetics | 5q35.1 |
Refseq ORF | 1587 |
Synonyms | BTRC2; BTRCP2; FBW1B; Fbw11; FBXW1B; Hos; NEDJED |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Hedgehog signaling pathway, Oocyte meiosis, Ubiquitin mediated proteolysis, Wnt signaling pathway |
Shipping | Dry Ice |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409480 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409481 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC415862 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409480 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2 |
CNY 3080.00 |
|
LY409481 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 1 |
CNY 4840.00 |
|
LY415862 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 3 |
CNY 4840.00 |
|
PH304407 | FBXW11 MS Standard C13 and N15-labeled recombinant protein (NP_387448) |
CNY 19520.00 |
其它beta TRCP2产品