NT5C3L (NT5C3B) (NM_052935) Human Recombinant Protein
CAT#: TP304354
Recombinant protein of human 5'-nucleotidase, cytosolic III-like (NT5C3L), 20 µg
View other "NT5C3L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204354 protein sequence
Red=Cloning site Green=Tags(s) MKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIISEECRKELT ALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKTFFNTLYHN NIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQ LEGKTNVILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHI LCQGVQLEMQGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_443167 |
| Locus ID | 115024 |
| UniProt ID | Q969T7 |
| Refseq Size | 1430 |
| Cytogenetics | 17q21.2 |
| Refseq ORF | 876 |
| Synonyms | cN-IIIB; NT5C3L |
| Summary | Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate (PubMed:23223233, PubMed:24603684). The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids (PubMed:23223233). Also has weak activity for CMP (PubMed:23223233, PubMed:24603684). UMP and purine nucleotides are poor substrates (PubMed:23223233).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409391 | NT5C3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409391 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III-like (NT5C3L) |
CNY 3080.00 |
|
| PH304354 | NT5C3L MS Standard C13 and N15-labeled recombinant protein (NP_443167) |
CNY 19520.00 |
