PRR13 (NM_018457) Human Recombinant Protein
CAT#: TP304313
Recombinant protein of human proline rich 13 (PRR13), transcript variant 2, 20 µg
View other "PRR13" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204313 protein sequence
Red=Cloning site Green=Tags(s) MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPG CQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSS SSSSSDSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060927 |
Locus ID | 54458 |
UniProt ID | Q9NZ81 |
Refseq Size | 1262 |
Cytogenetics | 12q13.13 |
Refseq ORF | 444 |
Synonyms | TXR1 |
Summary | Negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413037 | PRR13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413037 | Transient overexpression lysate of proline rich 13 (PRR13), transcript variant 2 |
CNY 3080.00 |
|
PH304313 | PRR13 MS Standard C13 and N15-labeled recombinant protein (NP_060927) |
CNY 19520.00 |
|
TP761525 | Purified recombinant protein of Human proline rich 13 (PRR13), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |