Superoxide Dismutase 3 (SOD3) (NM_003102) Human Recombinant Protein
CAT#: TP304156
Recombinant protein of human superoxide dismutase 3, extracellular (SOD3), 20 µg
View other "Superoxide Dismutase 3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204156 protein sequence
Red=Cloning site Green=Tags(s) MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSAT LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV GVCGPGLWERQAREHSERKKRRRESECKAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003093 |
| Locus ID | 6649 |
| UniProt ID | P08294 |
| Refseq Size | 1546 |
| Cytogenetics | 4p15.2 |
| Refseq ORF | 720 |
| Synonyms | EC-SOD |
| Summary | This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. [provided by RefSeq, Oct 2015] |
| Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Cross-tissue omics analysis discovers ten adipose genes encoding secreted proteins in obesity-related non-alcoholic fatty liver disease
,null,
eBioMedicine
,PubMed ID 37224770
[SOD3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418899 | SOD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418899 | Transient overexpression lysate of superoxide dismutase 3, extracellular (SOD3) |
CNY 3080.00 |
|
| PH304156 | SOD3 MS Standard C13 and N15-labeled recombinant protein (NP_003093) |
CNY 19520.00 |
其它Superoxide Dismutase 3产品
