EB3 (MAPRE3) (NM_012326) Human Recombinant Protein
CAT#: TP304135
Recombinant protein of human microtubule-associated protein, RP/EB family, member 3 (MAPRE3), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204135 protein sequence
Red=Cloning site Green=Tags(s) MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE Y myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036458 |
| Locus ID | 22924 |
| UniProt ID | Q9UPY8 |
| Refseq Size | 1880 |
| Cytogenetics | 2p23.3 |
| Refseq ORF | 843 |
| Synonyms | EB3; EBF3; EBF3-S; RP3 |
| Summary | The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008] |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The NAP motif of activity-dependent neuroprotective protein (ADNP) regulates dendritic spines through microtubule end binding proteins.
,null,
Molecular psychiatry
,PubMed ID 25178163
[MAPRE3]
|
|
A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum
,null,
Nature methods
,PubMed ID 23524392
[MAPRE3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415770 | MAPRE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415770 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 3 (MAPRE3) |
CNY 3080.00 |
|
| PH304135 | MAPRE3 MS Standard C13 and N15-labeled recombinant protein (NP_036458) |
CNY 19520.00 |


