SGK2 (NM_170693) Human Recombinant Protein
CAT#: TP304101
Recombinant protein of human serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1, 20 µg
View other "SGK2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204101 protein sequence
Red=Cloning site Green=Tags(s) MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKS ILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYA AEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEP YDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSK ADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASS AFLGFSYAPEDDDILDC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733794 |
Locus ID | 10110 |
UniProt ID | Q9HBY8 |
Refseq Size | 1913 |
Cytogenetics | 20q13.12 |
Refseq ORF | 1101 |
Synonyms | dJ138B7.2; H-SGK2 |
Summary | This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406797 | SGK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414080 | SGK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY406797 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1 |
CNY 3080.00 |
|
LY414080 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 2 |
CNY 4840.00 |
|
PH304101 | SGK2 MS Standard C13 and N15-labeled recombinant protein (NP_733794) |
CNY 19520.00 |