SMOC1 (NM_001034852) Human Recombinant Protein
CAT#: TP304083
Recombinant protein of human SPARC related modular calcium binding 1 (SMOC1), transcript variant 1, 20 µg
View other "SMOC1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204083 protein sequence
Red=Cloning site Green=Tags(s) MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDGRSYESMCEYQ RAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGEDGSFTQVQCHTYTGYCWCVT PDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKD SKLNNTNIRNSEKVYSCDQERQSALEEAQQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPL PGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRF SEPDPSHTLEERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE LKGCLGVSKEVGRLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001030024 |
Locus ID | 64093 |
UniProt ID | Q9H4F8 |
Refseq Size | 3716 |
Cytogenetics | 14q24.2 |
Refseq ORF | 1305 |
Synonyms | OAS |
Summary | This gene encodes a multi-domain secreted protein that may have a critical role in ocular and limb development. Mutations in this gene are associated with microphthalmia and limb anomalies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A strategy for discovery of endocrine interactions with application to whole-body metabolism
,null,
Cell metabolism
,PubMed ID 29719227
[SMOC1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400412 | SMOC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411742 | SMOC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400412 | Transient overexpression lysate of SPARC related modular calcium binding 1 (SMOC1), transcript variant 1 |
CNY 3080.00 |
|
LY411742 | Transient overexpression lysate of SPARC related modular calcium binding 1 (SMOC1), transcript variant 2 |
CNY 4840.00 |
|
PH304083 | SMOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001030024) |
CNY 19520.00 |