TRAX (TSNAX) (NM_005999) Human Recombinant Protein
CAT#: TP304023
Recombinant protein of human translin-associated factor X (TSNAX), 20 µg
View other "TRAX" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204023 protein sequence
Red=Cloning site Green=Tags(s) MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRT IFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTR SLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGD IDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKT EMIDQEEGIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005990 |
| Locus ID | 7257 |
| UniProt ID | Q99598 |
| Refseq Size | 2667 |
| Cytogenetics | 1q42.2 |
| Refseq ORF | 870 |
| Synonyms | C3PO; TRAX |
| Summary | This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416944 | TSNAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416944 | Transient overexpression lysate of translin-associated factor X (TSNAX) |
CNY 3080.00 |
|
| PH304023 | TSNAX MS Standard C13 and N15-labeled recombinant protein (NP_005990) |
CNY 19520.00 |
