IMP4 (NM_033416) Human Recombinant Protein
CAT#: TP304015
Recombinant protein of human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), 20 µg
View other "IMP4" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204015 protein sequence
Red=Cloning site Green=Tags(s) MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSH VDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVH EHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVP KDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTN TARKRVFLSTE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_219484 |
Locus ID | 92856 |
UniProt ID | Q96G21 |
Refseq Size | 1074 |
Cytogenetics | 2q21.1 |
Refseq ORF | 873 |
Synonyms | BXDC4 |
Summary | The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409541 | IMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409541 | Transient overexpression lysate of IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4) |
CNY 3080.00 |
|
PH304015 | IMP4 MS Standard C13 and N15-labeled recombinant protein (NP_219484) |
CNY 19520.00 |
|
TP761748 | Purified recombinant protein of Human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |