LITAF (NM_004862) Human Recombinant Protein
CAT#: TP303938
Recombinant protein of human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1, 20 µg
View other "LITAF" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203938 protein sequence
Red=Cloning site Green=Tags(s) MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN NNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDA LQDVDHYCPNCRALLGTYKRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004853 |
| Locus ID | 9516 |
| UniProt ID | Q99732 |
| Refseq Size | 2642 |
| Cytogenetics | 16p13.13 |
| Refseq ORF | 483 |
| Synonyms | PIG7; SIMPLE; TP53I7 |
| Summary | Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417698 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427883 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427884 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417698 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1 |
CNY 3080.00 |
|
| LY427883 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 2 |
CNY 3080.00 |
|
| LY427884 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 3 |
CNY 3080.00 |
|
| PH303938 | LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) |
CNY 19520.00 |
