LMO4 (NM_006769) Human Recombinant Protein
CAT#: TP303914
Recombinant protein of human LIM domain only 4 (LMO4), 20 µg
View other "LMO4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203914 protein sequence
Red=Cloning site Green=Tags(s) MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD RPTALINGHLNSLQSNPLLPDQKVC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006760 |
Locus ID | 8543 |
UniProt ID | P61968 |
Refseq Size | 5415 |
Cytogenetics | 1p22.3 |
Refseq ORF | 495 |
Summary | This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq, Aug 2008] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Cisplatin-induced Ototoxicity Is Mediated by Nitroxidative Modification of Cochlear Proteins Characterized by Nitration of Lmo4
,Samson Jamesdaniel, Donald Coling, Sneha Hinduja, Dalian Ding, Jun Li, Linda Cassidy, Gail M. Seigel, Jun Qu, and Richard Salvi,
J. Biol. Chem., May 2012; 287: 18674 - 18686.
[LMO4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |