TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein
CAT#: TP303848
Recombinant protein of human T-cell immunoglobulin and mucin domain containing 4 (TIMD4), 20 µg
View other "TIM 4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203848 protein sequence
Red=Cloning site Green=Tags(s) MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT RLDYIGDSKNVLNDVQHGREDEDGLFTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612388 |
| Locus ID | 91937 |
| UniProt ID | Q96H15 |
| Refseq Size | 1374 |
| Cytogenetics | 5q33.3 |
| Refseq ORF | 1134 |
| Synonyms | SMUCKLER; TIM4 |
| Summary | Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408645 | TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431308 | TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408645 | Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 1 |
CNY 3080.00 |
|
| LY431308 | Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 2 |
CNY 3080.00 |
|
| PH303848 | TIMD4 MS Standard C13 and N15-labeled recombinant protein (NP_612388) |
CNY 19520.00 |
