KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein
CAT#: TP303823
Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3, 20 µg
View other "KChIP2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203823 protein sequence
Red=Cloning site Green=Tags(s) MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH RPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDG SVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREH VESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_775284 |
| Locus ID | 30819 |
| UniProt ID | Q9NS61 |
| Refseq Size | 2509 |
| Cytogenetics | 10q24.32 |
| Refseq ORF | 756 |
| Synonyms | KCHIP2 |
| Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406637 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406638 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406642 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415190 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406637 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 2 |
CNY 3080.00 |
|
| LY406638 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 3 |
CNY 3080.00 |
|
| LY406642 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 7 |
CNY 3080.00 |
|
| LY415190 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 1 |
CNY 3080.00 |
|
| PH303823 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775284) |
CNY 19520.00 |
|
| PH313131 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_055406) |
CNY 14250.00 |
|
| PH319876 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) |
CNY 19520.00 |
|
| TP313131 | Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP319876 | Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 2, 20 µg |
CNY 2900.00 |
