CD14 (NM_000591) Human Recombinant Protein
CAT#: TP303819
Recombinant protein of human CD14 molecule (CD14), transcript variant 1, 20 µg
View other "CD14" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203819 representing NM_000591
Red=Cloning site Green=Tags(s) MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP ACARSTLSVGVSGTLVLLQGARGFA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000582 |
Locus ID | 929 |
UniProt ID | P08571 |
Refseq Size | 1623 |
Cytogenetics | 5q31.3 |
Refseq ORF | 1125 |
Summary | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2020] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Hematopoietic cell lineage, MAPK signaling pathway, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421877 | CD14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424624 | CD14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421877 | Transient overexpression lysate of CD14 molecule (CD14), transcript variant 2 |
CNY 3080.00 |
|
LY424624 | Transient overexpression lysate of CD14 molecule (CD14), transcript variant 1 |
CNY 3080.00 |
|
PH303819 | CD14 MS Standard C13 and N15-labeled recombinant protein (NP_000582) |
CNY 19520.00 |
|
PH318181 | CD14 MS Standard C13 and N15-labeled recombinant protein (NP_001035110) |
CNY 19520.00 |
|
TP318181 | Recombinant protein of human CD14 molecule (CD14), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP700277 | Purified recombinant protein of human CD14 molecule (CD14), transcript variant 1, with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
TP723883 | Purified recombinant protein of Human CD14 molecule (CD14), transcript variant 1 |
CNY 3210.00 |