PYK2 (PTK2B) (NM_004103) Human Recombinant Protein
CAT#: TP303808
Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2, 20 µg
View other "PYK2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203808 protein sequence
Red=Cloning site Green=Tags(s) MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHR HNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVV KNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTAS HTLAVDAKNLLDAVDQAKVLANLAHPPAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 115.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004094 |
| Locus ID | 2185 |
| UniProt ID | Q14289 |
| Refseq Size | 4193 |
| Cytogenetics | 8p21.2 |
| Refseq ORF | 3027 |
| Synonyms | CADTK; CAKB; FADK2; FAK2; PKB; PTK; PYK2; RAFTK |
| Summary | This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, Chemokine signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401325 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406631 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406632 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401325 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2 |
CNY 3080.00 |
|
| LY406631 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1 |
CNY 3080.00 |
|
| LY406632 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4 |
CNY 4840.00 |
|
| PH303808 | PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_004094) |
CNY 14250.00 |
|
| PH305372 | PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775266) |
CNY 19520.00 |
|
| PH317684 | PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775267) |
CNY 19520.00 |
|
| TP305372 | Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317684 | Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4, 20 µg |
CNY 2900.00 |
