CCDC28B (NM_024296) Human Recombinant Protein
CAT#: TP303631
Recombinant protein of human coiled-coil domain containing 28B (CCDC28B), 20 µg
View other "CCDC28B" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC203631 protein sequence 
Red=Cloning site Green=Tags(s) MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGS GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG EEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 21.9 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_077272 | 
| Locus ID | 79140 | 
| UniProt ID | Q9BUN5 | 
| Refseq Size | 1110 | 
| Cytogenetics | 1p35.2 | 
| Refseq ORF | 600 | 
| Summary | The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC411317 | CCDC28B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY411317 | Transient overexpression lysate of coiled-coil domain containing 28B (CCDC28B) | 
                                                     CNY 3080.00  | 
                                            |
| PH303631 | CCDC28B MS Standard C13 and N15-labeled recombinant protein (NP_077272) | 
                                                     CNY 19520.00  | 
                                            
其它CCDC28B产品
