ERGIC1 (NM_001031711) Human Recombinant Protein
CAT#: TP303612
Recombinant protein of human endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1), 20 µg
View other "ERGIC1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203612 protein sequence
Red=Cloning site Green=Tags(s) MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKID VSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQ PQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYT VANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEA WKKIQLGKMH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001026881 |
| Locus ID | 57222 |
| UniProt ID | Q969X5 |
| Refseq Size | 2949 |
| Cytogenetics | 5q35.1 |
| Refseq ORF | 870 |
| Synonyms | AMC2; AMCN; ERGIC-32; ERGIC32; NET24 |
| Summary | This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412466 | ERGIC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422162 | ERGIC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412466 | Transient overexpression lysate of endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1), transcript variant 2 |
CNY 3080.00 |
|
| LY422162 | Transient overexpression lysate of endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1) |
CNY 3080.00 |
|
| PH303612 | ERGIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001026881) |
CNY 19520.00 |
