NUBP2 (NM_012225) Human Recombinant Protein
CAT#: TP303571
Recombinant protein of human nucleotide binding protein 2 (MinD homolog, E. coli) (NUBP2), 20 µg
View other "NUBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203571 protein sequence
Red=Cloning site Green=Tags(s) MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVH QCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDE HMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGG GEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036357 |
Locus ID | 10101 |
UniProt ID | Q9Y5Y2 |
Refseq Size | 1408 |
Cytogenetics | 16p13.3 |
Refseq ORF | 813 |
Synonyms | CFD1; CIAO6; NBP 2; NUBP1 |
Summary | This gene encodes an adenosine triphosphate (ATP) and metal-binding protein that is required for the assembly of cyotosolic iron-sulfur proteins. The encoded protein functions in a heterotetramer with nucleotide-binding protein 1 (NUBP1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415900 | NUBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415900 | Transient overexpression lysate of nucleotide binding protein 2 (MinD homolog, E. coli) (NUBP2) |
CNY 3080.00 |
|
PH303571 | NUBP2 MS Standard C13 and N15-labeled recombinant protein (NP_036357) |
CNY 19520.00 |