RERG (NM_032918) Human Recombinant Protein
CAT#: TP303564
Recombinant protein of human RAS-like, estrogen-regulated, growth inhibitor (RERG), 20 µg
View other "RERG" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203564 protein sequence
Red=Cloning site Green=Tags(s) MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116307 |
| Locus ID | 85004 |
| UniProt ID | Q96A58 |
| Refseq Size | 2325 |
| Cytogenetics | 12p12.3 |
| Refseq ORF | 597 |
| Summary | RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409869 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434024 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409869 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG) |
CNY 3080.00 |
|
| LY434024 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG), transcript variant 2 |
CNY 3080.00 |
|
| PH303564 | RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307) |
CNY 19520.00 |
