RCC1 (NM_001048199) Human Recombinant Protein
CAT#: TP303556
Recombinant protein of human SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 3, 20 µg
View other "RCC1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203556 protein sequence
Red=Cloning site Green=Tags(s) MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001041664 |
| Locus ID | 1104 |
| UniProt ID | P18754 |
| Refseq Size | 2715 |
| Cytogenetics | 1p35.3 |
| Refseq ORF | 1263 |
| Synonyms | CHC1; RCC1-I; SNHG3-RCC1 |
| Summary | Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:1944575, PubMed:17435751, PubMed:20668449, PubMed:22215983, PubMed:11336674). Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis (PubMed:12194828, PubMed:17435751, PubMed:22215983). Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import (PubMed:22215983). Involved in the regulation of onset of chromosome condensation in the S phase (PubMed:3678831). Binds both to the nucleosomes and double-stranded DNA (PubMed:17435751, PubMed:18762580).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420036 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420775 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420778 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420036 | Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 3 |
CNY 4840.00 |
|
| LY420775 | Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 2 |
CNY 4840.00 |
|
| LY420778 | Transient overexpression lysate of SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 1 |
CNY 3080.00 |
|
| PH303556 | SNHG3 MS Standard C13 and N15-labeled recombinant protein (NP_001041664) |
CNY 19520.00 |
|
| PH321798 | RCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001260) |
CNY 19520.00 |
|
| TP321798 | Recombinant protein of human regulator of chromosome condensation 1 (RCC1), transcript variant 3, 20 µg |
CNY 2900.00 |
