KLHDC3 (NM_057161) Human Recombinant Protein
CAT#: TP303552
Recombinant protein of human kelch domain containing 3 (KLHDC3), 20 µg
View other "KLHDC3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203552 protein sequence
Red=Cloning site Green=Tags(s) MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQA PVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIM YIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNE IYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKK IEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYN LDQSCLPHDIRWELNAMTTNSNISRPIVSSHG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_476502 |
Locus ID | 116138 |
UniProt ID | Q9BQ90 |
Refseq Size | 2029 |
Cytogenetics | 6p21.1 |
Refseq ORF | 1146 |
Synonyms | dJ20C7.3; PEAS |
Summary | The protein encoded by this gene contains six repeated kelch motifs that are structurally similar to recombination activating gene 2, a protein involved in the activation of the V(D)J recombination. In mouse, this gene is found to be expressed specifically in testis. Its expression in pachytene spermatocytes is localized to cytoplasma and meiotic chromatin, suggesting that this gene may be involved in meiotic recombination. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409263 | KLHDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409263 | Transient overexpression lysate of kelch domain containing 3 (KLHDC3) |
CNY 3080.00 |
|
PH303552 | KLHDC3 MS Standard C13 and N15-labeled recombinant protein (NP_476502) |
CNY 19520.00 |