XLF (NHEJ1) (NM_024782) Human Recombinant Protein
CAT#: TP303393
Recombinant protein of human nonhomologous end-joining factor 1 (NHEJ1), 20 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC203393 protein sequence 
Red=Cloning site Green=Tags(s) MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA AFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLM GMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPF VMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGP LQRPQLSKVKRKKPRGLFS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 33.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_079058 | 
| Locus ID | 79840 | 
| UniProt ID | Q9H9Q4 | 
| Refseq Size | 2119 | 
| Cytogenetics | 2q35 | 
| Refseq ORF | 897 | 
| Synonyms | XLF | 
| Summary | Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq, Jul 2008] | 
| Protein Pathways | Non-homologous end-joining | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403031 | NHEJ1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403031 | Transient overexpression lysate of nonhomologous end-joining factor 1 (NHEJ1) | 
                                                     CNY 3080.00  | 
                                            |
| PH303393 | NHEJ1 MS Standard C13 and N15-labeled recombinant protein (NP_079058) | 
                                                     CNY 19520.00  | 
                                            
