KIAA1191 (NM_001079685) Human Recombinant Protein
CAT#: TP303372
Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3, 20 µg
View other "KIAA1191" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203372 protein sequence
Red=Cloning site Green=Tags(s) MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKV EEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTT EETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDS GSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVM EGKKQPPRAHNLKPRDLNVLTPTGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073153 |
Locus ID | 57179 |
UniProt ID | Q96A73 |
Refseq Size | 2738 |
Cytogenetics | 5q35.2 |
Refseq ORF | 915 |
Synonyms | p33MONOX; p60MONOX |
Summary | Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412452 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421535 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421536 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412452 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 1 |
CNY 3080.00 |
|
LY421535 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 2 |
CNY 3080.00 |
|
LY421536 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 3 |
CNY 3080.00 |
|
PH303372 | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_001073153) |
CNY 19520.00 |
|
PH318066 | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) |
CNY 19520.00 |
|
TP318066 | Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 1, 20 µg |
CNY 2900.00 |
其它KIAA1191产品