hnRNP A1 (HNRNPA1) (NM_002136) Human Recombinant Protein
CAT#: TP303314
Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1, 20 µg
View other "hnRNP A1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 4 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203314 protein sequence
Red=Cloning site Green=Tags(s) MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN FGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Binding assay (PMID: 29762696) |
| Reference Data | |
| RefSeq | NP_002127 |
| Locus ID | 3178 |
| UniProt ID | P09651 |
| Refseq Size | 1785 |
| Cytogenetics | 12q13.13 |
| Refseq ORF | 960 |
| Synonyms | ALS19; ALS20; hnRNP-A1; hnRNP A1; HNRPA1; HNRPA1L3; IBMPFD3; UP 1 |
| Summary | This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016] |
| Protein Pathways | Spliceosome |
Citations (4)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Small molecules inhibitors of the heterogeneous ribonuclear protein A18 (hnRNP A18): a regulator of protein translation and an immune checkpoint
,null,
Nucleic Acids Research
,PubMed ID 33398344
[HNRNPA1]
|
|
Identification of hnRNP-A1 as a pharmacodynamic biomarker of type I PRMT inhibition in blood and tumor tissues
,Noto, PB;Sikorski, TW;Zappacosta, F;Wagner, CD;Montes de Oca, R;Szapacs, ME;Annan, RS;Liu, Y;McHugh, CF;Mohammad, HP;Piccoli, SP;Creasy, CL;,
Scientific reports
,PubMed ID 33335114
[HNRNPA1]
|
|
Blocking of an intronic splicing silencer completely rescues IKBKAP exon 20 splicing in familial dysautonomia patient cells
,Bruun, GH;Bang, JM;Christensen, LL;Brøner, S;Petersen, US;Guerra, B;Grønning, AG;Doktor, TK;Andresen, BS;,
Nucleic Acids Res.
,PubMed ID 29762696
[HNRNPA1]
|
|
HNRNPA1 interacts with a 5'-flanking distal element of interleukin-6 and upregulates its basal transcription
,D Zheng, J Worthington, J F Timms & P Woo,
Genes and Immunity doi:10.1038/gene.2013.41
,PubMed ID 23985572
[HNRNPA1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400778 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410582 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400778 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1 |
CNY 3080.00 |
|
| LY410582 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2 |
CNY 3080.00 |
|
| PH303314 | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_002127) |
CNY 19520.00 |
|
| PH311626 | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_112420) |
CNY 19520.00 |
|
| TP311626 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它hnRNP A1产品
