RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein
CAT#: TP303271
Recombinant protein of human recombination activating gene 1 activating protein 1 (RAG1AP1), transcript variant 1, 20 µg
View other "RAG1AP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203271 protein sequence
Red=Cloning site Green=Tags(s) MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILI VVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISM YLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQ EQDRNYWLLQT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061333 |
Locus ID | 55974 |
UniProt ID | Q9BRV3 |
Refseq Size | 1363 |
Cytogenetics | 1q22 |
Refseq ORF | 663 |
Synonyms | HsSWEET1; RAG1AP1; SCP; slv; SWEET1 |
Summary | Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402706 | SLC50A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402706 | Transient overexpression lysate of recombination activating gene 1 activating protein 1 (RAG1AP1), transcript variant 1 |
CNY 3080.00 |
|
PH303271 | RAG1AP1 MS Standard C13 and N15-labeled recombinant protein (NP_061333) |
CNY 19520.00 |
其它RAG1AP1产品