Calprotectin (S100A8) (NM_002964) Human Recombinant Protein
CAT#: TP303255
Purified recombinant protein of Homo sapiens S100 calcium binding protein A8 (S100A8), 20 µg
View other "S100A8" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203255 representing NM_002964
Red=Cloning site Green=Tags(s) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE FLILVIKMGVAAHKKSHEESHKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002955 |
| Locus ID | 6279 |
| UniProt ID | P05109 |
| Refseq Size | 532 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 279 |
| Synonyms | 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8 |
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| PH303255 | S100A8 MS Standard C13 and N15-labeled recombinant protein (NP_002955) |
CNY 14250.00 |
|
| TP750184 | Purified recombinant protein of Human S100 calcium binding protein A8 (S100A8), full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 2840.00 |
|
| TP750185 | Purified recombinant protein of Human Calprotectin antigen (S100A8/S100A9), full length, with C-His tag in the S100A8 and C-DDK Tag in the S100A9, expressed in E.coli, 50ug |
CNY 2840.00 |


