CD36 (NM_000072) Human Recombinant Protein
CAT#: TP303254
Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3, 20 µg
View other "CD36" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203254 protein sequence
Red=Cloning site Green=Tags(s) MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000063 |
| Locus ID | 948 |
| UniProt ID | P16671 |
| Refseq Size | 2108 |
| Cytogenetics | 7q21.11 |
| Refseq ORF | 1416 |
| Synonyms | BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3 |
| Summary | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400018 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424372 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424373 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400018 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 |
CNY 3080.00 |
|
| LY424372 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 |
CNY 4840.00 |
|
| LY424373 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 |
CNY 4840.00 |
|
| PH303254 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063) |
CNY 19520.00 |
|
| PH321976 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548) |
CNY 14250.00 |
|
| PH325799 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915) |
CNY 14250.00 |
|
| PH325800 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) |
CNY 14250.00 |
|
| TP321976 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325799 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP325800 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP710013 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell |
CNY 4020.00 |
