COLEC11 (NM_199235) Human Recombinant Protein
CAT#: TP303199
Recombinant protein of human collectin sub-family member 11 (COLEC11), transcript variant 2, 20 µg
View other "COLEC11" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203199 protein sequence
Red=Cloning site Green=Tags(s) MTPALCRSSSLASKGMRERRETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGDK GQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAV AGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGA FVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954705 |
Locus ID | 78989 |
UniProt ID | Q9BWP8 |
Refseq Size | 1784 |
Cytogenetics | 2p25.3 |
Refseq ORF | 804 |
Synonyms | 3MC2; CL-11; CL-K1-I; CL-K1-II; CL-K1-IIa; CL-K1-IIb; CLK1 |
Summary | This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404629 | COLEC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411405 | COLEC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404629 | Transient overexpression lysate of collectin sub-family member 11 (COLEC11), transcript variant 2 |
CNY 3080.00 |
|
LY411405 | Transient overexpression lysate of collectin sub-family member 11 (COLEC11), transcript variant 1 |
CNY 3080.00 |
|
PH303199 | COLEC11 MS Standard C13 and N15-labeled recombinant protein (NP_954705) |
CNY 19520.00 |
其它COLEC11产品