Iba1 (AIF1) (NM_032955) Human Recombinant Protein
CAT#: TP303154M
Recombinant protein of human allograft inflammatory factor 1 (AIF1), transcript variant 1, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203154 representing NM_032955
Red=Cloning site Green=Tags(s) MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY EEKAREKEKPTGPPAKKAISELP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116573 |
| Locus ID | 199 |
| UniProt ID | P55008 |
| Refseq Size | 503 |
| Cytogenetics | 6p21.33 |
| Refseq ORF | 279 |
| Synonyms | AIF-1; IBA1; IRT-1; IRT1 |
| Summary | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
