CORO1B (NM_020441) Human Recombinant Protein
CAT#: TP303023
Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 1, 20 µg
View other "CORO1B" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203023 protein sequence
Red=Cloning site Green=Tags(s) MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065174 |
| Locus ID | 57175 |
| UniProt ID | Q9BR76 |
| Refseq Size | 1927 |
| Cytogenetics | 11q13.2 |
| Refseq ORF | 1467 |
| Synonyms | CORONIN-2 |
| Summary | Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402787 | CORO1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422721 | CORO1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402787 | Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 |
CNY 3080.00 |
|
| LY422721 | Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 2 |
CNY 4840.00 |
|
| PH303023 | CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_065174) |
CNY 19520.00 |
|
| PH322047 | CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_001018080) |
CNY 19520.00 |
|
| TP322047 | Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 2, 20 µg |
CNY 2900.00 |
