CHCHD6 (NM_032343) Human Recombinant Protein
CAT#: TP302975
Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6), 20 µg
View other "CHCHD6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202975 protein sequence
Red=Cloning site Green=Tags(s) MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD RPHEVLLCSDLVKAYQRCVSAAHKG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115719 |
| Locus ID | 84303 |
| UniProt ID | Q9BRQ6 |
| Refseq Size | 1020 |
| Cytogenetics | 3q21.3 |
| Refseq ORF | 705 |
| Synonyms | CHCM1; Mic25; MICOS25; PPP1R23 |
| Summary | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
A CHCHD6–APP axis connects amyloid and mitochondrial pathology in Alzheimer’s disease
,null,
Acta Neuropathologica
,PubMed ID 36104602
[CHCHD6]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410180 | CHCHD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410180 | Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6) |
CNY 3080.00 |
|
| PH302975 | CHCHD6 MS Standard C13 and N15-labeled recombinant protein (NP_115719) |
CNY 19520.00 |
