PLA2G12A (NM_030821) Human Recombinant Protein
CAT#: TP302955
Recombinant protein of human phospholipase A2, group XIIA (PLA2G12A), 20 µg
View other "PLA2G12A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202955 representing NM_030821
Red=Cloning site Green=Tags(s) MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_110448 |
| Locus ID | 81579 |
| UniProt ID | Q9BZM1 |
| Refseq Size | 1699 |
| Cytogenetics | 4q25 |
| Refseq ORF | 567 |
| Synonyms | GXII; PLA2G12; ROSSY |
| Summary | Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Tumor-promoting effects of pancreatic cancer cell exosomes on THP-1-derived macrophages
,Linton, SS;Abraham, T;Liao, J;Clawson, GA;Butler, PJ;Fox, T;Kester, M;Matters, GL;,
PLoS ONE
,PubMed ID 30383833
[PLA2G12A]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410681 | PLA2G12A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410681 | Transient overexpression lysate of phospholipase A2, group XIIA (PLA2G12A) |
CNY 3080.00 |
|
| PH302955 | PLA2G12A MS Standard C13 and N15-labeled recombinant protein (NP_110448) |
CNY 19520.00 |
|
| TP701054 | Purified recombinant protein of Human phospholipase A2, group XIIA (PLA2G12A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
其它PLA2G12A产品


