RRAD (NM_004165) Human Recombinant Protein
CAT#: TP302927
Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg
View other "RRAD" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202927 representing NM_004165
Red=Cloning site Green=Tags(s) MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR FLGRIVARNSRKMAFRAKSKSCHDLSVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004156 |
| Locus ID | 6236 |
| UniProt ID | P55042 |
| Refseq Size | 1443 |
| Cytogenetics | 16q22.1 |
| Refseq ORF | 924 |
| Synonyms | RAD; RAD1; REM3 |
| Summary | May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418172 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427008 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418172 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 |
CNY 3080.00 |
|
| LY427008 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 |
CNY 3080.00 |
|
| PH302927 | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156) |
CNY 19520.00 |
|
| PH325433 | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) |
CNY 19520.00 |
|
| TP325433 | Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg |
CNY 2900.00 |
