Cpn10 (HSPE1) (NM_002157) Human Recombinant Protein
CAT#: TP302891L
Recombinant protein of human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202891 protein sequence
Red=Cloning site Green=Tags(s) MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002148 |
| Locus ID | 3336 |
| UniProt ID | P61604 |
| Refseq Size | 965 |
| Cytogenetics | 2q33.1 |
| Refseq ORF | 306 |
| Synonyms | CPN10; EPF; GROES; HSP10 |
| Summary | This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
