PMVK (NM_006556) Human Recombinant Protein
CAT#: TP302867
Recombinant protein of human phosphomevalonate kinase (PMVK), 20 µg
View other "PMVK" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202867 protein sequence
Red=Cloning site Green=Tags(s) MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKE AFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQ RGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006547 |
| Locus ID | 10654 |
| UniProt ID | Q15126 |
| Refseq Size | 1307 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 576 |
| Synonyms | HUMPMKI; PMK; PMKA; PMKASE; POROK1 |
| Summary | This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416571 | PMVK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416571 | Transient overexpression lysate of phosphomevalonate kinase (PMVK) |
CNY 3080.00 |
|
| PH302867 | PMVK MS Standard C13 and N15-labeled recombinant protein (NP_006547) |
CNY 19520.00 |
|
| TP720221 | Recombinant protein of human phosphomevalonate kinase (PMVK) |
CNY 1800.00 |
