cvHSP (HSPB7) (NM_014424) Human Recombinant Protein
CAT#: TP302861
Recombinant protein of human heat shock 27kDa protein family, member 7 (cardiovascular) (HSPB7), 20 µg
View other "cvHSP" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202861 protein sequence
Red=Cloning site Green=Tags(s) MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA LREDGSLTIRARRHPHTEHVQQTFRTEIKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055239 |
Locus ID | 27129 |
UniProt ID | Q9UBY9 |
Refseq Size | 2908 |
Cytogenetics | 1p36.13 |
Refseq ORF | 510 |
Synonyms | cvHSP |
Summary | This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway, with defects in this gene being associated with renal cell carcinoma. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415289 | HSPB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415289 | Transient overexpression lysate of heat shock 27kDa protein family, member 7 (cardiovascular) (HSPB7) |
CNY 3080.00 |
|
PH302861 | HSPB7 MS Standard C13 and N15-labeled recombinant protein (NP_055239) |
CNY 19520.00 |
|
TP721015 | Purified recombinant protein of Human heat shock 27kDa protein family, member 7 (cardiovascular) (HSPB7) |
CNY 1800.00 |