CAPZA2 (NM_006136) Human Recombinant Protein
CAT#: TP302764
Recombinant protein of human capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2), 20 µg
View other "CAPZA2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202764 protein sequence
Red=Cloning site Green=Tags(s) MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGY EDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGV CTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHK DIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG KEMQNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006127 |
Locus ID | 830 |
UniProt ID | P47755 |
Refseq Size | 2373 |
Cytogenetics | 7q31.2 |
Refseq ORF | 858 |
Synonyms | CAPPA2; CAPZ |
Summary | The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416843 | CAPZA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416843 | Transient overexpression lysate of capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2) |
CNY 3080.00 |
|
PH302764 | CAPZA2 MS Standard C13 and N15-labeled recombinant protein (NP_006127) |
CNY 19520.00 |
|
TP761515 | Purified recombinant protein of Human capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |