CDK7 (NM_001799) Human Recombinant Protein
CAT#: TP302736
Recombinant protein of human cyclin-dependent kinase 7 (CDK7), 20 µg
View other "CDK7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202736 protein sequence
Red=Cloning site Green=Tags(s) MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001790 |
| Locus ID | 1022 |
| UniProt ID | P50613 |
| Refseq Size | 1534 |
| Cytogenetics | 5q13.2 |
| Refseq ORF | 1038 |
| Synonyms | CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1 |
| Summary | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cell cycle, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419742 | CDK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419742 | Transient overexpression lysate of cyclin-dependent kinase 7 (CDK7) |
CNY 3080.00 |
|
| PH302736 | CDK7 MS Standard C13 and N15-labeled recombinant protein (NP_001790) |
CNY 19520.00 |

