GLP1 (GCG) (NM_002054) Human Recombinant Protein
CAT#: TP302717
Purified recombinant protein of Homo sapiens glucagon (GCG), 20 µg
View other "GLP1" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC202717 protein sequence 
Red=Cloning site Green=Tags(s) MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 18.6 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002045 | 
| Locus ID | 2641 | 
| UniProt ID | P01275 | 
| Refseq Size | 1294 | 
| Cytogenetics | 2q24.2 | 
| Refseq ORF | 540 | 
| Synonyms | GLP-1; GLP1; GLP2; GRPP | 
| Summary | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419562 | GCG HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419562 | Transient overexpression lysate of glucagon (GCG) | 
                                                     CNY 3080.00  | 
                                            |
| PH302717 | GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045) | 
                                                     CNY 14250.00  | 
                                            |
| TP720706 | Purified recombinant protein of Human glucagon (GCG) | 
                                                     CNY 1800.00  | 
                                            
