CRSP9 (MED7) (NM_004270) Human Recombinant Protein
CAT#: TP302696
Recombinant protein of human mediator complex subunit 7 (MED7), transcript variant 2, 20 µg
View other "CRSP9" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202696 representing NM_004270
Red=Cloning site Green=Tags(s) MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH RRDQIIEKDAALCVLIDEMNERP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004261 |
Locus ID | 9443 |
UniProt ID | O43513 |
Refseq Size | 1066 |
Cytogenetics | 5q33.3 |
Refseq ORF | 699 |
Synonyms | ARC34; CRSP9; CRSP33 |
Summary | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418057 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420292 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418057 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 2 |
CNY 3080.00 |
|
LY420292 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 1 |
CNY 3080.00 |
|
PH302696 | MED7 MS Standard C13 and N15-labeled recombinant protein (NP_004261) |
CNY 19520.00 |
|
TP761746 | Purified recombinant protein of Human mediator complex subunit 7 (MED7), transcript variant 1, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |