SERPINB3 (NM_006919) Human Recombinant Protein
CAT#: TP302683
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), 20 µg
View other "SERPINB3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202683 protein sequence
Red=Cloning site Green=Tags(s) MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.4 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008850 |
| Locus ID | 6317 |
| UniProt ID | P29508 |
| Refseq Size | 1793 |
| Cytogenetics | 18q21.33 |
| Refseq ORF | 1170 |
| Synonyms | HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A |
| Summary | May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The kinetic profile and clinical implication of SCC-Ag in squamous cervical cancer patients undergoing radical hysterectomy using the Simoa assay: a prospective observational study
,Ye, S;Sun, X;Kang, B;Wu, F;Zheng, Z;Xiang, L;Lesénéchal, M;Heskia, F;Liang, J;Yang, H;,
BMC Cancer
,PubMed ID 32085736
[SERPINB3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416321 | SERPINB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416321 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) |
CNY 3080.00 |
|
| PH302683 | SERPINB3 MS Standard C13 and N15-labeled recombinant protein (NP_008850) |
CNY 19520.00 |
|
| TP790063 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), with N-terminal HIS tag, expressed in HEK293, 50ug |
CNY 3900.00 |
其它SERPINB3产品


