S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein
CAT#: TP302590M
Recombinant protein of human S100 calcium binding protein A14 (S100A14), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202590 protein sequence
Red=Cloning site Green=Tags(s) MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065723 |
| Locus ID | 57402 |
| UniProt ID | Q9HCY8 |
| Refseq Size | 1075 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 312 |
| Synonyms | BCMP84; S100A15 |
| Summary | This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
其它S100 calcium binding protein A14产品
