PIN1 (NM_006221) Human Recombinant Protein
CAT#: TP302543
Recombinant protein of human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), 20 µg
View other "PIN1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202543 protein sequence
Red=Cloning site Green=Tags(s) MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA LRTGEMSGPVFTDSGIHIILRTE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006212 |
Locus ID | 5300 |
UniProt ID | Q13526 |
Refseq Size | 1138 |
Cytogenetics | 19p13.2 |
Refseq ORF | 489 |
Synonyms | DOD; UBL5 |
Summary | Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | RIG-I-like receptor signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Analysis of binding interfaces of the human scaffold protein AXIN1 by peptide microarrays
,Harnoš, J;Ryneš, J;Víšková, P;Trantírková, SF;Ešner, LB;Trantírek, L;Bryja, V;,
J. Biol. Chem.
,PubMed ID 30166345
[PIN1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401873 | PIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401873 | Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
CNY 3080.00 |
|
PH302543 | PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212) |
CNY 19520.00 |