GOLPH3L (NM_018178) Human Recombinant Protein
CAT#: TP302398
Recombinant protein of human golgi phosphoprotein 3-like (GOLPH3L), 20 µg
View other "GOLPH3L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202398 protein sequence
Red=Cloning site Green=Tags(s) MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA AFNKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060648 |
| Locus ID | 55204 |
| UniProt ID | Q9H4A5 |
| Refseq Size | 3208 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 855 |
| Synonyms | GPP34R |
| Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413097 | GOLPH3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413097 | Transient overexpression lysate of golgi phosphoprotein 3-like (GOLPH3L) |
CNY 3080.00 |
|
| PH302398 | GOLPH3L MS Standard C13 and N15-labeled recombinant protein (NP_060648) |
CNY 19520.00 |
其它GOLPH3L产品
