SYNJ2BP (NM_018373) Human Recombinant Protein

CAT#: TP302394

Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "SYNJ2BP" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00

CNY 6650.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
SYNJ2BP mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
    • 100 ul

CNY 1999.00
CNY 2700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC202394 protein sequence
Red=Cloning site Green=Tags(s)

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR
YRQQL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_060843
Locus ID 55333
UniProt ID P57105
Refseq Size 7074
Cytogenetics 14q24.2
Refseq ORF 435
Synonyms ARIP2; OMP25
Summary Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...