DPF2 (NM_006268) Human Recombinant Protein
CAT#: TP302364
Recombinant protein of human D4, zinc and double PHD fingers family 2 (DPF2), 20 µg
View other "DPF2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202364 protein sequence
Red=Cloning site Green=Tags(s) MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006259 |
Locus ID | 5977 |
UniProt ID | Q92785 |
Refseq Size | 2545 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1173 |
Synonyms | CSS7; REQ; ubi-d4; UBID4 |
Summary | The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401888 | DPF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401888 | Transient overexpression lysate of D4, zinc and double PHD fingers family 2 (DPF2) |
CNY 3080.00 |
|
PH302364 | DPF2 MS Standard C13 and N15-labeled recombinant protein (NP_006259) |
CNY 19520.00 |