SNX3 (NM_003795) Human Recombinant Protein
CAT#: TP302354
Recombinant protein of human sorting nexin 3 (SNX3), transcript variant 1, 20 µg
View other "SNX3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202354 protein sequence
Red=Cloning site Green=Tags(s) MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRR YSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERC LHMFLQDEIIDKSYTPSKIRHA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003786 |
| Locus ID | 8724 |
| UniProt ID | O60493 |
| Refseq Size | 1777 |
| Cytogenetics | 6q21 |
| Refseq ORF | 486 |
| Synonyms | Grd19; MCOPS8; SDP3 |
| Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like most family members. This protein interacts with phosphatidylinositol-3-phosphate, and is involved in protein trafficking. A pseudogene of this gene is present on the sex chromosomes. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418430 | SNX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418430 | Transient overexpression lysate of sorting nexin 3 (SNX3), transcript variant 1 |
CNY 3080.00 |
|
| PH302354 | SNX3 MS Standard C13 and N15-labeled recombinant protein (NP_003786) |
CNY 19520.00 |
