UBLCP1 (NM_145049) Human Recombinant Protein
CAT#: TP302342
Recombinant protein of human ubiquitin-like domain containing CTD phosphatase 1 (UBLCP1), 20 µg
View other "UBLCP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202342 representing NM_145049
Red=Cloning site Green=Tags(s) MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNT KIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLL VLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFM LDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDK DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659486 |
Locus ID | 134510 |
UniProt ID | Q8WVY7 |
Refseq Size | 2178 |
Cytogenetics | 5q33.3 |
Refseq ORF | 954 |
Synonyms | CPUB1 |
Summary | Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408066 | UBLCP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408066 | Transient overexpression lysate of ubiquitin-like domain containing CTD phosphatase 1 (UBLCP1) |
CNY 3080.00 |
|
PH302342 | UBLCP1 MS Standard C13 and N15-labeled recombinant protein (NP_659486) |
CNY 19520.00 |